Structure of PDB 8kcc Chain G Binding Site BS01

Receptor Information
>8kcc Chain G (length=80) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTY
TEHARRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8kcc Chain I (length=150) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcctggagaatcccggtgccgaggccgctcaattggtcgtagacagctc
tagcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgcca
aggggattactccctagtctccaggcacgtgtcacatatatacatcctgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kcc Mechanism of heterochromatin remodeling revealed by the DDM1 bound nucleosome structures.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T30 P32 R36
Binding residue
(residue number reindexed from 1)		T8 P10 R14
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0009414 response to water deprivation
Cellular Component
GO:0000325 plant-type vacuole
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005777 peroxisome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009506 plasmodesma
GO:0009507 chloroplast
GO:0009536 plastid
GO:0009579 thylakoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kcc, PDBe:8kcc, PDBj:8kcc
PDBsum8kcc
PubMed38870940
UniProtP59259|H4_ARATH Histone H4 (Gene Name=At1g07660)

[Back to BioLiP]