Structure of PDB 8jkn Chain G Binding Site BS01

Receptor Information
>8jkn Chain G (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAAL
FKAWALFKGKFREGIDKPDPPTWKRRLRCALNKSNDFEELVERSQLDISD
PYKVYRIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jkn Molecular basis for the functional roles of the multimorphic T95R mutation of IRF4 causing human autosomal dominant combined immunodeficiency.
Resolution2.92 Å
Binding residue
(original residue number in PDB)		W54 H56 A57 R98 N102
Binding residue
(residue number reindexed from 1)		W34 H36 A37 R78 N82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8jkn, PDBe:8jkn, PDBj:8jkn
PDBsum8jkn
PubMed37683642
UniProtF2Z3D5

[Back to BioLiP]