Structure of PDB 8jbx Chain G Binding Site BS01

Receptor Information

>8jbx Chain G (length=107) Species: 9606 (Homo sapiens)

AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNI
QAVLLPK

Ligand information

>8jbx Chain I (length=145)

tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccga

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8jbx Human canonical 601 DNA nucleosome
• Resolution: 3.35 Å
• Binding residue (original residue number in PDB): R29 R42 V43 G44 A45 K75 R77
• Binding residue (residue number reindexed from 1): R18 R31 V32 G33 A34 K64 R66

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0008285 negative regulation of cell population proliferation
• GO:0031507 heterochromatin formation
• GO:0061644 protein localization to CENP-A containing chromatin

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0043505 CENP-A containing nucleosome
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:8jbx, PDBe:8jbx, PDBj:8jbx
• PDBsum: 8jbx
• UniProt: P04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)