Structure of PDB 8if1 Chain G Binding Site BS01

Receptor Information
>8if1 Chain G (length=277) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRA
PWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMF
GCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEA
AHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEA
TLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVV
PSGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8if1 Complex structure of HLA-A*24:02 and SARS-Cov-2 epitope NYNYLFRLF with Y453F mutation
Resolution Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 H70 T73 E76 N77 I80 Y84 M97 F99 Y116 Y123 T143 K146 W147 Q156 Y159 T163 R170 Y171
Binding residue
(residue number reindexed from 1)		Y8 E64 K67 H71 T74 E77 N78 I81 Y85 M98 F100 Y117 Y124 T144 K147 W148 Q157 Y160 T164 R171 Y172
Enzymatic activity
Enzyme Commision number ?
External links