Structure of PDB 8hih Chain G Binding Site BS01

Receptor Information
>8hih Chain G (length=57) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEV
KIKLHQL
Ligand information
>8hih Chain L (length=77) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgcatccgtgagtcgagggtaataaacgcagcgcggtttcggtggaagcc
cctcgttgtttcgccgccgtgacgaag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hih Structural insights into the transcription activation mechanism of the global regulator GlnR from actinobacteria.
Resolution3.66 Å
Binding residue
(original residue number in PDB)
R259 R287 N288 G290
Binding residue
(residue number reindexed from 1)
R12 R40 N41 G43
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0016779 nucleotidyltransferase activity
GO:0034062 5'-3' RNA polymerase activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006351 DNA-templated transcription
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8hih, PDBe:8hih, PDBj:8hih
PDBsum8hih
PubMed37216560
UniProtP9WGZ1|RPOA_MYCTU DNA-directed RNA polymerase subunit alpha (Gene Name=rpoA)

[Back to BioLiP]