Structure of PDB 8h0i Chain G Binding Site BS01

Receptor Information
>8h0i Chain G (length=129) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MENRWQVMIVWQVDRMRINTWKRLVKHHMYISRKAKDWFYRHHYESTNPK
ISSEVHIPLGDAKLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDP
DLADQLIHLHYFDPPLPSVRKLTEDRWNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h0i Structural insights into RNA bridging between HIV-1 Vif and antiviral factor APOBEC3G.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R15 R17 T20 R23 L24 P49 W70 L81 S165 K168
Binding residue
(residue number reindexed from 1)		R15 R17 T20 R23 L24 P49 W70 L81 S118 K121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019058 viral life cycle

View graph for
Biological Process
External links
PDB RCSB:8h0i, PDBe:8h0i, PDBj:8h0i
PDBsum8h0i
PubMed37419875
UniProtP12504|VIF_HV1N5 Virion infectivity factor (Gene Name=vif)

[Back to BioLiP]