Structure of PDB 8gsv Chain G Binding Site BS01

Receptor Information
>8gsv Chain G (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSEEQVAQDTEEVFRSYVFYRHQQEQEADPEMVTLPLQPSSTMGQVGRQL
AIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRV
VALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGWV
AALN
Ligand information
>8gsv Chain H (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEIIHKLAMQLRHIGDNIDHRMV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gsv Structural basis for proapoptotic activation of Bak by the noncanonical BH3-only protein Pxt1.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		I81 D84 I85 Y89 F93 M96 L100 K113 I114 S117 L118 S121 N124 G126 R127 A130 F134
Binding residue
(residue number reindexed from 1)		I53 D56 I57 Y61 F65 M68 L72 K85 I86 S89 L90 S93 N96 G98 R99 A102 F106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:8gsv, PDBe:8gsv, PDBj:8gsv
PDBsum8gsv
PubMed37315086
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]