Structure of PDB 8ghm Chain G Binding Site BS01

Receptor Information
>8ghm Chain G (length=376) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVVKFPWLAHREESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSIL
RCMELESLTPEIPLPQDLQMPLCSMSRHTGSITCVKFSPDGKYLASGSDD
RILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPDSS
ILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVFDPANKYFATTSDD
RTMKIFRYHKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDGQHIAVP
NATNGPVSSVAIVNRGTWDTNVSLIGHDAPTEVARFNPRLFEIDSVVATA
GQDKSLAVWSTSRPRPILVAFDIANKSITDMSWNPDGSLLFVASLDSSIT
LFKFENNELGKPIPLEKNMEQLYRYG
Ligand information
>8ghm Chain D (length=10) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MSMFNALNSN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ghm Structure of the Hir histone chaperone complex.
Resolution12.0 Å
Binding residue
(original residue number in PDB)		D243 H246 I262 I324 S326 T342 S343 P345 R405
Binding residue
(residue number reindexed from 1)		D243 H246 I262 I293 S295 T311 S312 P314 R374
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0031491 nucleosome binding
GO:0042802 identical protein binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006338 chromatin remodeling
GO:0006368 transcription elongation by RNA polymerase II
GO:0016480 negative regulation of transcription by RNA polymerase III
GO:1905268 negative regulation of chromatin organization
Cellular Component
GO:0000417 HIR complex
GO:0000775 chromosome, centromeric region
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ghm, PDBe:8ghm, PDBj:8ghm
PDBsum8ghm
PubMed38925115
UniProtP32479|HIR1_YEAST Protein HIR1 (Gene Name=HIR1)

[Back to BioLiP]