Structure of PDB 8gan Chain G Binding Site BS01

Receptor Information
>8gan Chain G (length=124) Species: 486 (Neisseria lactamica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLDRNRQDIGYVLGRLFAVLEKIQAEANPGLNATIADRYFGSASSTPIAV
FGTLMRLLPHHLNKLEFEGRAVQLQWEIRQILEHCQRFPNHLNLEQQGLF
AIGYYHETQFLFTKDALKNLFNEA
Ligand information
>8gan Chain L (length=53) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggagggcgagggcgatgccacctacggcaagctgaccctgaagttcatc
tgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gan Exploiting activation and inactivation mechanisms in type I-C CRISPR-Cas3 for genome-editing applications.
Resolution3.26 Å
Binding residue
(original residue number in PDB)		Q25 A34 L58 H61 H62
Binding residue
(residue number reindexed from 1)		Q24 A33 L57 H60 H61
Enzymatic activity
Enzyme Commision number ?
External links