Structure of PDB 8g9u Chain G Binding Site BS01

Receptor Information
>8g9u Chain G (length=124) Species: 486 (Neisseria lactamica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLDRNRQDIGYVLGRLFAVLEKIQAEANPGLNATIADRYFGSASSTPIAV
FGTLMRLLPHHLNKLEFEGRAVQLQWEIRQILEHCQRFPNHLNLEQQGLF
AIGYYHETQFLFTKDALKNLFNEA
Ligand information
>8g9u Chain L (length=53) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggagggcgagggcgatgccacctacggcaagctgaccctgaagttcatc
tgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g9u Exploiting activation and inactivation mechanisms in type I-C CRISPR-Cas3 for genome-editing applications.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Q25 L32 N33 R39 L58 H61 H62 K65
Binding residue
(residue number reindexed from 1)		Q24 L31 N32 R38 L57 H60 H61 K64
Enzymatic activity
Enzyme Commision number ?
External links