Structure of PDB 8g8n Chain G Binding Site BS01

Receptor Information
>8g8n Chain G (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTNYFMNWVRQAPGQGLEWMGR
VDPEQGRADYAEKFKKRVTITADKSTSTAYMELSSLRSEDTAVYYCARRA
MDNYGFAYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKKVEPKSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g8n XTX101, a tumor-activated, Fc-enhanced anti-CTLA-4 monoclonal antibody, demonstrates tumor-growth inhibition and tumor-selective pharmacodynamics in mouse models of cancer.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T30 F33 R50 D52 E54 R99 Y104
Binding residue
(residue number reindexed from 1)		T30 F33 R50 D52 E54 R99 Y104
External links