Structure of PDB 8fs6 Chain G Binding Site BS01

Receptor Information
>8fs6 Chain G (length=298) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKFSASTVHLEHITTALSCLTPFGSKDDVLIFIDADGLSFVRENNHVIKI
QLLLSRELFMSYSYRNETEDHMKLCVKINHILDSVSVMNRNSDDIVECTL
SYDGHGSPFVLIFEDSFISERVEYSTYLIKDFDTNGLELDRERISFEAII
KGEALHSALKDLKEIGCKECYVYAKTEANDENVFALISKSQLGFSKIKLP
SNRSILEKLQVFDGDSTTVIDGFAVIGFFDFTSFDKIRKSTKIASKVLFR
MDVHGVLSVNILSQLPKDYPGIVIEVCMLEKESIDEAAQTEIELLMET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fs6 Structures of 9-1-1 DNA checkpoint clamp loading at gaps from start to finish and ramification to biology.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K34 K171
Binding residue
(residue number reindexed from 1)		K26 K163
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003690 double-stranded DNA binding
GO:0004518 nuclease activity
GO:0005515 protein binding
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0007131 reciprocal meiotic recombination
Cellular Component
GO:0005634 nucleus
GO:0030896 checkpoint clamp complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fs6, PDBe:8fs6, PDBj:8fs6
PDBsum8fs6
PubMed37205533
UniProtP48581|RAD17_YEAST DNA damage checkpoint control protein RAD17 (Gene Name=RAD17)

[Back to BioLiP]