Structure of PDB 8fb5 Chain G Binding Site BS01

Receptor Information
>8fb5 Chain G (length=230) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCEASGFTFSNFGMHWVRQTPVKGLEWVAI
IWFDGSYKYYTDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARAR
KGQRSDYYGSETKYTFDNWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGG
TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV
PSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Ligand information
>8fb5 Chain K (length=9) Species: 5843 (Plasmodium falciparum NF54) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPDPNANPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fb5 Molecular determinants of cross-reactivity and potency by VH3-33 antibodies against the Plasmodium falciparum circumsporozoite protein
Resolution2.9 Å
Binding residue
(original residue number in PDB)		N31 F32 G33 W52 F52A Y56 Y58 A95 K100I Y100J
Binding residue
(residue number reindexed from 1)		N31 F32 G33 W52 F53 Y57 Y59 A99 K113 Y114
External links