Structure of PDB 8f7z Chain G Binding Site BS01

Receptor Information
>8f7z Chain G (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVLVQSGAEVKKPGASVKVSCRAFGYTFTGNPLHWVRQAPGQGLEWLGWI
NPHSGDTFTSQKFQGRVYMTRDKSINTAFLDVTRLTSDDTGIYYCARDKY
YGNEAVGMDVWGQGTSVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKKVEP
Ligand information
>8f7z Chain M (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGTIGAM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f7z Structural mechanism for broad HIV-1 fusion peptide neutralization revealed by directed antibody evolution
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T30 G31 N32 P33 W50 N52 Y97 N100 E100A A100B
Binding residue
(residue number reindexed from 1)		T29 G30 N31 P32 W49 N51 Y100 N103 E104 A105
External links