Structure of PDB 8ehq Chain G Binding Site BS01

Receptor Information
>8ehq Chain G (length=110) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEEETDIKNGK
KKVVKKKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLL
PGEAETILKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ehq Allosteric mechanism of transcription inhibition by NusG-dependent pausing of RNA polymerase.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y11 D73 W76 R80 T86
Binding residue
(residue number reindexed from 1)		Y9 D71 W74 R78 T84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006354 DNA-templated transcription elongation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ehq, PDBe:8ehq, PDBj:8ehq
PDBsum8ehq
PubMed36745813
UniProtQ06795|NUSG_BACSU Transcription termination/antitermination protein NusG (Gene Name=nusG)

[Back to BioLiP]