Structure of PDB 8dtn Chain G Binding Site BS01

Receptor Information
>8dtn Chain G (length=117) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVQLVESGGGLVQAGGSLRLSCAASGFIFDSYAMGWYRQAPGKEMELVAA
ITSSGSSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAALD
YVIDGYWGQGTQVTVSS
Ligand information
>8dtn Chain H (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DVYKCEICKMPFSVYSTLEKHMKKWHSD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dtn Evolution of nanobodies specific for BCL11A.
Resolution2.199 Å
Binding residue
(original residue number in PDB)
Y37 E44 L47 A50 T52 S57 Y59 L99 D100 V102 I103
Binding residue
(residue number reindexed from 1)
Y37 E44 L47 A50 T52 S57 Y59 L99 D100 V102 I103
External links