Structure of PDB 8bmw Chain G Binding Site BS01

Receptor Information
>8bmw Chain G (length=238) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDLDVITTVVKIEGKLRNETLLRVGKGKTQDFAEATDNPIIKYRDRPLIP
GSSLKGAFRSLVESYTKSLNDSKYYVCDLDDNSCVSCEEKKKIVEGRYCI
PCILFGFKDLASRVYILDAIAEKYSISQRTMVAINRVFGGQMPGHLYTLD
YVDPGSEFSFMMMIYNLNLIEGEKDWKAKSVEALKFLLATLVREGIFVGA
RKSVGYGLIKLVDAKVSLYKAPDHLVSPVIVKKLEEVI
Ligand information
>8bmw Chain R (length=48) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auugaaaguuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bmw Structure of the Saccharolobus solfataricus type III-D CRISPR effector.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		G28 K29 G30 S55 S56 K58 G59 R62 F113 K114 L116 A117 S118 T136 M137 V138 A139 I140 G146 M148 Y153 G205 A206 R207 K208 S209
Binding residue
(residue number reindexed from 1)		G25 K26 G27 S52 S53 K55 G56 R59 F107 K108 L110 A111 S112 T130 M131 V132 A133 I134 G140 M142 Y147 G199 A200 R201 K202 S203
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8bmw, PDBe:8bmw, PDBj:8bmw
PDBsum8bmw
PubMed36843655
UniProtQ97YA7

[Back to BioLiP]