Structure of PDB 8b8i Chain G Binding Site BS01

Receptor Information
>8b8i Chain G (length=115) Species: 30538 (Vicugna pacos) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLVESGGGLVQTGGSLRLSCTASGSIGSISVMGWYRQVPGTQYELVAGIS
RGGSTWYEDSVKGRFTISRDNAKNTLYLQMNSLKPEDTGMYYCAGGDYSD
RLGSWGQGTQVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b8i Nanobody (NbLumSyt1) bound to human Syt1
Resolution2.75 Å
Binding residue
(original residue number in PDB)		V34 Y101 D103 R104 L105
Binding residue
(residue number reindexed from 1)		V31 Y98 D100 R101 L102
External links