Structure of PDB 7xyb Chain G Binding Site BS01

Receptor Information
>7xyb Chain G (length=168) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STEQALAVAYWMFEQQPGPRSSTAMVIDSLRERFDRRFIERLPSGLSPHE
WQAQAVMTVRFAQRQLAAHPLELAVVRAEFARGRDFVLGLAALRDWLKPA
AGPIEQRAALALLMRMFRRPPSSIREIERLSGLSKSTLHRWDKEWRERVA
ALLRQALLRLEEPMAQVG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xyb Structural basis of AlpA-dependent transcription antitermination.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
G48 L49
Binding residue
(residue number reindexed from 1)
G45 L46
Enzymatic activity
Enzyme Commision number ?
External links