Structure of PDB 7xfj Chain G Binding Site BS01

Receptor Information
>7xfj Chain G (length=108) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPN
IQSVLLPK
Ligand information
>7xfj Chain I (length=131) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctgacacgcgcctggagactagggagtaatccccttggcggttaaaacgc
gggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgacc
aattgagcggcctcggcaccgggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xfj Structural and mechanistic insights into the DNA glycosylase AAG-mediated base excision in nucleosome.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R11 R29 R42 V43 G44 T76 R77
Binding residue
(residue number reindexed from 1)		R1 R19 R32 V33 G34 T66 R67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7xfj, PDBe:7xfj, PDBj:7xfj
PDBsum7xfj
PubMed37339965
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]