Structure of PDB 7vzg Chain G Binding Site BS01

Receptor Information
>7vzg Chain G (length=38) Species: 458033 (Chloracidobacterium thermophilum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DISKVAWAWFGVLLAICLIGAFGNYVPKLFVKMLMFLN
Ligand information
>7vzg Chain H (length=19) Species: 458033 (Chloracidobacterium thermophilum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vzg Structure of the Acidobacteria homodimeric reaction center bound with cytochrome c.
Resolution2.61 Å
Binding residue
(original residue number in PDB)
Y32 K35 V38
Binding residue
(residue number reindexed from 1)
Y25 K28 V31
Enzymatic activity
Enzyme Commision number ?
External links