Structure of PDB 7vwz Chain G Binding Site BS01

Receptor Information
>7vwz Chain G (length=114) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIIRDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHIGYIRA
RRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRRS
PEWSAFGIRPPLRL
Ligand information
>7vwz Chain 1 (length=65) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgacagcactgaatgtcaaaacaaaaccttcactcgcaactataatggga
gctgtcacggatgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vwz Structural basis of transcription activation by Rob, a pleiotropic AraC/XylS family regulator.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		Y33 S34 W36 H37 R40 T87 R90
Binding residue
(residue number reindexed from 1)		Y29 S30 W32 H33 R36 T81 R84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vwz, PDBe:7vwz, PDBj:7vwz
PDBsum7vwz
PubMed35641097
UniProtP0ACI0|ROB_ECOLI Right origin-binding protein (Gene Name=rob)

[Back to BioLiP]