Structure of PDB 7vwo Chain G Binding Site BS01

Receptor Information
>7vwo Chain G (length=142) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRV
VTNRRVFTEPTSPQDAWQAVDALLAAPAAMRLRPGERHWMAFRQLASDVD
ANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLD
Ligand information
>7vwo Chain H (length=28) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YRVQPSGKGGLRPGVDLSSNAALAEAMN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vwo TA complex from Mycobacterium tuberculosis
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y11 H13 R14 D16 H20 R24 E28 A31 N32 R49 N53 R54 R55 V56 F57 T58 E59 A72 L73 A76 N104 D108 D126 F129
Binding residue
(residue number reindexed from 1)		Y11 H13 R14 D16 H20 R24 E28 A31 N32 R49 N53 R54 R55 V56 F57 T58 E59 A72 L73 A76 N104 D108 D126 F129
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004518 nuclease activity
GO:0004540 RNA nuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
GO:0046872 metal ion binding
Biological Process
GO:0045926 negative regulation of growth

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7vwo, PDBe:7vwo, PDBj:7vwo
PDBsum7vwo
PubMed
UniProtP9WF55|VPC43_MYCTU Ribonuclease VapC43 (Gene Name=vapC43)

[Back to BioLiP]