Structure of PDB 7vo9 Chain G Binding Site BS01

Receptor Information
>7vo9 Chain G (length=131) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPVKGRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTL
QSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVE
KWAEAIAAEHGYVNVAHTVEIFGTCADCAGA
Ligand information
>7vo9 Chain A (length=43) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caaggcacatgacaacggtgttcagtgccgcgttgcccgatac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vo9 Structural basis of Streptomyces transcription activation by zinc uptake regulator.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		G10 T13 Q15 R16 G47 T49 T50 R53
Binding residue
(residue number reindexed from 1)		G5 T8 Q10 R11 G42 T44 T45 R48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vo9, PDBe:7vo9, PDBj:7vo9
PDBsum7vo9
PubMed35871291
UniProtQ9L2H5

[Back to BioLiP]