Structure of PDB 7tve Chain G Binding Site BS01

Receptor Information
>7tve Chain G (length=307) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPQLEFKVLQGYRDLESEMHKGRAQVTRTGDIGVAMDNLNAVDSLFNKVI
GIKNNGLFAHDARAMVSISELAQISVRNLKFDDSRSMVNLENIVNSLKRY
MLKEHFKLNNIAENRNATSSFKATSMRHSYLQQFSHYNEFSQFNWFRIGA
LYNTISKNAPITDHLMGPLSIEKKPRVLTQRRRNNDQVGEKITPEQVKKC
FKKLSKKLGPEGSINLFKFIIDPNSFSRSIENLFYTSFLIKEGKLLMEHD
EEGLPTIKIKQSISHTDSRSKEIERQRRRAAHQNHIIFQMDMPTWRKLIK
KYNITSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tve Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		L253 R257
Binding residue
(residue number reindexed from 1)		L178 R182
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019789 SUMO transferase activity
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0016925 protein sumoylation
GO:0032204 regulation of telomere maintenance
GO:0140588 chromatin looping
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0030915 Smc5-Smc6 complex
GO:0032991 protein-containing complex
GO:0043232 intracellular non-membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tve, PDBe:7tve, PDBj:7tve
PDBsum7tve
PubMed35648833
UniProtP43124|NSE4_YEAST Non-structural maintenance of chromosome element 4 (Gene Name=NSE4)

[Back to BioLiP]