Structure of PDB 7swy Chain G Binding Site BS01

Receptor Information
>7swy Chain G (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLP
Ligand information
>7swy Chain I (length=143) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagca
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7swy Nucleosome recognition and DNA distortion by the Chd1 remodeler in a nucleotide-free state.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R35 R42 K75 T76 R77
Binding residue
(residue number reindexed from 1)		R24 R31 K64 T65 R66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7swy, PDBe:7swy, PDBj:7swy
PDBsum7swy
PubMed35173352
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]