Structure of PDB 7sl5 Chain G Binding Site BS01

Receptor Information
>7sl5 Chain G (length=229) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGGGVVQPGESLRLSCSGSGFTFNNYIMHWVRQAPGQGLDYVSG
IGSDGRNTNYGDSVKGRFTISRDNSKDTLYLQMTSLRAEDTAFYYCVKGL
DVLRFLDLSTPSGERLDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SSLGTQTYICNVNHKPSNTKVDKRVEPKS
Ligand information
>7sl5 Chain I (length=13) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSKRSFIEDLLFN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sl5 ACE2-binding exposes the SARS-CoV-2 fusion peptide to broadly neutralizing coronavirus antibodies.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
N31 S53 D54 R56 N57 T58 D101
Binding residue
(residue number reindexed from 1)
N31 S53 D54 R56 N57 T58 D101
External links