Structure of PDB 7sg1 Chain G Binding Site BS01

Receptor Information

>7sg1 Chain G (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTL
LGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTIS
PNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVML
EMTPQRGDVYTCHVEHPSLQSPITVEWRA

Ligand information

>7sg1 Chain H (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QPFPQPELPYGSGGS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7sg1 Structural basis of T cell receptor specificity and cross-reactivity of two HLA-DQ2.5-restricted gluten epitopes in celiac disease.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	F11 G13 L26 Y60 W61 I67 R77 V78 N82
Binding residue (residue number reindexed from 1)	F9 G11 L24 Y58 W59 I65 R75 V76 N80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7sg1, PDBe:7sg1, PDBj:7sg1
PDBsum	7sg1
PubMed	35065967
UniProt	Q5Y7D3

[Back to BioLiP]