Structure of PDB 7s7b Chain G Binding Site BS01

Receptor Information
>7s7b Chain G (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVN
FKHEVSVPYAMNLLNGIKLYGRPIKIQFR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7s7b Structural basis for RNA surveillance by the human nuclear exosome targeting (NEXT) complex.
Resolution4.06 Å
Binding residue
(original residue number in PDB)		F13 N16 P42 F52 F54 K81 Q83
Binding residue
(residue number reindexed from 1)		F7 N10 P36 F46 F48 K75 Q77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7s7b, PDBe:7s7b, PDBj:7s7b
PDBsum7s7b
PubMed35688134
UniProtQ9Y580|RBM7_HUMAN RNA-binding protein 7 (Gene Name=RBM7)

[Back to BioLiP]