Structure of PDB 7rgu Chain G Binding Site BS01

Receptor Information
>7rgu Chain G (length=115) Species: 446 (Legionella pneumophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSNKAQKNQSKRARSDALLWLAANFPEAFDNSLRIRPLKIGIMSDILQH
AEKAEQVGVSKSKLREAVVLFTRRLDYLACLKAREVRIDLHGNPVAEVTE
EEAENASMKIKKRVE
Ligand information
>7rgu Chain H (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugggucaaucuucggauuggcccuuucu
.<<<<<<<<<....>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rgu Structural basis for recognition of transcriptional terminator structures by ProQ/FinO domain RNA chaperones.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Q17 S21 K50 I51 G52 I53 M54 S70 K71 S72 K73 R75 V78 V79 Y87 R97 E112 K119
Binding residue
(residue number reindexed from 1)		Q7 S11 K40 I41 G42 I43 M44 S60 K61 S62 K63 R65 V68 V69 Y77 R87 E102 K109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0033592 RNA strand annealing activity
GO:0034057 RNA strand-exchange activity
Biological Process
GO:0010608 post-transcriptional regulation of gene expression

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7rgu, PDBe:7rgu, PDBj:7rgu
PDBsum7rgu
PubMed36400772
UniProtA0A3A6VMJ3

[Back to BioLiP]