Structure of PDB 7py0 Chain G Binding Site BS01

Receptor Information
>7py0 Chain G (length=123) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVV
EIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRP
APISDKEVDAIMNRLQQVGDKPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7py0 Transcription factors modulate RNA polymerase conformational equilibrium.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		F15 S16 M90
Binding residue
(residue number reindexed from 1)		F15 S16 M90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006354 DNA-templated transcription elongation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7py0, PDBe:7py0, PDBj:7py0
PDBsum7py0
PubMed35318334
UniProtP0AFG0|NUSG_ECOLI Transcription termination/antitermination protein NusG (Gene Name=nusG)

[Back to BioLiP]