Structure of PDB 7nl9 Chain G Binding Site BS01

Receptor Information
>7nl9 Chain G (length=42) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NMLTELAGASALDHPLLVEVEYVGTLYSFEPDPETLFDALLP
Ligand information
>7nl9 Chain C (length=8) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKVRKPAP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nl9 Structure of the ATP synthase from Mycobacterium smegmatis provides targets for treating tuberculosis.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		T55 G59 L68 E207 E209 Y210 V211
Binding residue
(residue number reindexed from 1)		T4 G8 L17 E19 E21 Y22 V23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:0042777 proton motive force-driven plasma membrane ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nl9, PDBe:7nl9, PDBj:7nl9
PDBsum7nl9
PubMed34782468
UniProtA0R201|ATPG_MYCS2 ATP synthase gamma chain (Gene Name=atpG)

[Back to BioLiP]