Structure of PDB 7nkb Chain G Binding Site BS01

Receptor Information

>7nkb Chain G (length=251) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

IKKITKAQELIATSRIAKAQARVEAARPYAAEITNMLTELAGASALDHPL
LVERKQPKRAGVLVVSSDRGLCGAYNANVLRRAEELFSLLRDEGKDPVLY
VVGRKALGYFSFRQRTVVESWTGFSERPTYENAREIADTLVNAFMAGADD
EGDDAGADGILGVDELHIVFTEFRSMLSQTAVARRAAPMEVEYVGEVGPR
TLYSFEPDPETLFDALLPRYIATRVYAALLEAAASESASRRRAMKSATDN
A

Ligand information

>7nkb Chain C (length=21) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

AEALDPEDLEKESVKVRKPAP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7nkb Structure of the ATP synthase from Mycobacterium smegmatis provides targets for treating tuberculosis.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): N52 T55 G59 E102 L103 S105 L106 A200 R201 R202 M206 E207 E209 Y210 V211 V214 R243
• Binding residue (residue number reindexed from 1): N35 T38 G42 E85 L86 S88 L89 A183 R184 R185 M189 E190 E192 Y193 V194 V197 R224

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0046933 proton-transporting ATP synthase activity, rotational mechanism

Biological Process

• GO:0006754 ATP biosynthetic process
• GO:0015986 proton motive force-driven ATP synthesis
• GO:0042777 proton motive force-driven plasma membrane ATP synthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

External links

• PDB: RCSB:7nkb, PDBe:7nkb, PDBj:7nkb
• PDBsum: 7nkb
• PubMed: 34782468
• UniProt: A0R201|ATPG_MYCS2 ATP synthase gamma chain (Gene Name=atpG)