Structure of PDB 7mkk Chain G Binding Site BS01

Receptor Information
>7mkk Chain G (length=71) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMKEKVKAKLVEIRKFVPFIRRVRIDFQDTLSKVQGHRLDALVNLLDRED
VSMSSLNKIEVIIDKLRTRFN
Ligand information
>7mkk Chain H (length=22) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPKIKEDADNAMLDSLLADPFE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mkk Panoramix SUMOylation on chromatin connects the piRNA pathway to the cellular heterochromatin machinery.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q50 R53 A56 L60 R63 D65 S67 S70 K73 I77 L81 R84
Binding residue
(residue number reindexed from 1)		Q35 R38 A41 L45 R48 D50 S52 S55 K58 I62 L66 R69
Enzymatic activity
Enzyme Commision number ?
External links