Structure of PDB 7m1x Chain G Binding Site BS01

Receptor Information
>7m1x Chain G (length=95) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEV
LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVI
Ligand information
>7m1x Chain I (length=136) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m1x Structural basis of chromatin regulation by histone variant H2A.Z.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R1031 K1037 R1045 V1046 G1047 V1078 K1079 R1080
Binding residue
(residue number reindexed from 1)		R16 K22 R30 V31 G32 V63 K64 R65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031490 chromatin DNA binding
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0071392 cellular response to estradiol stimulus
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0000792 heterochromatin
GO:0001740 Barr body
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m1x, PDBe:7m1x, PDBj:7m1x
PDBsum7m1x
PubMed34643712
UniProtP0C0S6|H2AZ_MOUSE Histone H2A.Z (Gene Name=H2az1)

[Back to BioLiP]