Structure of PDB 7lky Chain G Binding Site BS01

Receptor Information
>7lky Chain G (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDIS
PAALP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lky Discovery of an H3K36me3-Derived Peptidomimetic Ligand with Enhanced Affinity for Plant Homeodomain Finger Protein 1 (PHF1).
Resolution1.85 Å
Binding residue
(original residue number in PDB)		A39 R40 W41 L45 L46 Y47 F65 E66 D67 D68 F71 V73
Binding residue
(residue number reindexed from 1)		A10 R11 W12 L16 L17 Y18 F36 E37 D38 D39 F42 V44
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7lky, PDBe:7lky, PDBj:7lky
PDBsum7lky
PubMed33999620
UniProtO43189|PHF1_HUMAN PHD finger protein 1 (Gene Name=PHF1)

[Back to BioLiP]