Structure of PDB 7k7g Chain G Binding Site BS01

Receptor Information

>7k7g Chain G (length=100) Species: 559292 (Saccharomyces cerevisiae S288C)

QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQN

Ligand information

>7k7g Chain I (length=123)

tgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacgc
acgtacgcgctgtcccccgcgttttaatattagtgtatttgatttccgaa
agttaaaaaagaaatagtaagaa

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7k7g Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.
• Resolution: 4.2 Å
• Binding residue (original residue number in PDB): R37 R44 I45 S47
• Binding residue (residue number reindexed from 1): R21 R28 I29 S31

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0006281 DNA repair
• GO:0006325 chromatin organization
• GO:0031507 heterochromatin formation

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0031298 replication fork protection complex
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:7k7g, PDBe:7k7g, PDBj:7k7g
• PDBsum: 7k7g
• PubMed: 33741944
• UniProt: P04911|H2A1_YEAST Histone H2A.1 (Gene Name=HTA1)