Structure of PDB 7f75 Chain G Binding Site BS01

Receptor Information
>7f75 Chain G (length=129) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVTLYTSPSCTSCRKARAWLEEHDIPFVERNIFSEPLSIDEIKQILRMTE
DGTDEIISTRSKVFQKLNVNVESMPLQDLYRLINEHPGLLRRPIIIDEKR
LQVGYNEDEIRRFLPRKVRPFQLREAQRL
Ligand information
>7f75 Chain J (length=59) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcattaaaatagcgtgaacgaatgggagatgcttataatgggagctgtc
acggatgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f75 Structural basis of transcription activation by the global regulator Spx.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		S9 T11 R14 R60
Binding residue
(residue number reindexed from 1)		S9 T11 R14 R60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f75, PDBe:7f75, PDBj:7f75
PDBsum7f75
PubMed34530448
UniProtO31602|SPX_BACSU Global transcriptional regulator Spx (Gene Name=spx)

[Back to BioLiP]