Structure of PDB 7eyi Chain G Binding Site BS01

Receptor Information
>7eyi Chain G (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHM
RKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSD
HLHRHLKKDGC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eyi Structural basis for human ZBTB7A action at the fetal globin promoter.
Resolution2.401 Å
Binding residue
(original residue number in PDB)
Q422 N450 Y451 S478 D479 H482
Binding residue
(residue number reindexed from 1)
Q43 N71 Y72 S99 D100 H103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7eyi, PDBe:7eyi, PDBj:7eyi
PDBsum7eyi
PubMed34592153
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]