Structure of PDB 7evo Chain G Binding Site BS01

Receptor Information
>7evo Chain G (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQA
FVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGPNYILF
LNNLPEETNEMMLSMLFNQFPGFKEVRLDIAFVEFENDGQAGAARDALQG
FKITPSHAMKITYAKK
Ligand information
>7evo Chain H (length=148) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccggcuaagaucaaguguaguaucuguucuuaucaguuuaauaucugau
uccucgaggaggauuuuuggagcagggagauggaauaggagcuugcuccg
uccacuccacgcaucgaccugguauugcaguaccuccaggaacggugc
<<..>>...<<.<<.<<<...>>>.>>.>>..<<<<<........>>>>>
<<<<..>>>>...............<<<<.<<<<...<<<<....>>>>.
>>>>>>>>..<<<<<<.<<<<<.............>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7evo Structural Insights into Branch Site Proofreading by Human Spliceosome.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
N16 A45 K47 K50 R52 Y86 K88
Binding residue
(residue number reindexed from 1)
N11 A40 K42 K45 R47 Y81 K83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030619 U1 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7evo, PDBe:7evo, PDBj:7evo
PDBsum7evo
PubMed38196034
UniProtP08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' (Gene Name=SNRPB2)

[Back to BioLiP]