Structure of PDB 7eg6 Chain G Binding Site BS01

Receptor Information
>7eg6 Chain G (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNI
QSVLLPK
Ligand information
>7eg6 Chain M (length=18) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDKDKDRDTRRKRRQGRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eg6 Structure of the SWI/SNF complex bound to the nucleosome and insights into the functional modularity.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		E56 E61 E64 L65 D90 E91 E92
Binding residue
(residue number reindexed from 1)		E45 E50 E53 L54 D79 E80 E81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7eg6, PDBe:7eg6, PDBj:7eg6
PDBsum7eg6
PubMed33907182
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]