Structure of PDB 7c79 Chain G Binding Site BS01

Receptor Information
>7c79 Chain G (length=121) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSY
VAVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVITEGSDVED
DDKETQLKKRAVSGVELRIYV
Ligand information
>7c79 Chain A (length=331) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauccaugaccaaagaaucgucacaaaucgaagcuuacaaaauggaguaa
aauuuuguuuacucaguaauaugcuuuggguugaaagucucccaccaauu
cguaugcggaaaacguaaugagauuuaaaaauaauuguuuaaaucaacuc
auuaaggaggaugcccuuggguauucugcuucuugaccugguaccucuau
ugcaggguacugguguuuucuucgguacuggauuccguuuguauggaauc
uaaaccauaguuaugacgauugcucuuucccgugcuggaucgaguaaccc
aauggagcuuacuauucuugguccauggauu
<<<<<<<<<<<<<<.<<<<<<<......<<<<<<..........<<<<<<
<......>>>>>>>........>>>>>>[.......{.((((.<<<....
.....<<<.....>>><<<<.<..........................>>
>>><<<.<<<<<<<<....>>>>>>>>.>>>......<<<<<<<<<....
....>>>>>>>>>..........>>>...<<<<<<<<......>>>>>>>
>.............>>>>>>><<<<..<<<......>>>..>>>>...].
...)))).}...>....>>>>>>.>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c79 Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		V15 K17 H18 P19 S20 K22 T25 H26 F34 V35 K36 T39 Y41 V42 S43 L45 K46 R47 L66 M68 K70 I97 R129 A130 V131 S132
Binding residue
(residue number reindexed from 1)		V3 K5 H6 P7 S8 K10 T13 H14 F22 V23 K24 T27 Y29 V30 S31 L33 K34 R35 L54 M56 K58 I85 R110 A111 V112 S113
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Gene Ontology
Molecular Function
GO:0000171 ribonuclease MRP activity
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0034965 intronic box C/D snoRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:0005697 telomerase holoenzyme complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c79, PDBe:7c79, PDBj:7c79
PDBsum7c79
PubMed32586950
UniProtP38291|POP7_YEAST Ribonucleases P/MRP protein subunit POP7 (Gene Name=POP7)

[Back to BioLiP]