Structure of PDB 7b5f Chain G Binding Site BS01

Receptor Information
>7b5f Chain G (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLLYHLTAVSSPAPPAFWVSGWLGPQQYLSYNSLRLRIKEKLFLEAFKAL
GGKGPYTLQGLLGCELSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAI
SQRWQQQDKAANKELTFLLFSCPHRLREHLERG
Ligand information
>7b5f Chain H (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IQRTPKIQVSGFHPSDILSFSKDWSFYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b5f Structure of echovirus 18 in complex with neonatal Fc receptor
Resolution2.9 Å
Binding residue
(original residue number in PDB)		H10 L11 T12 W25 Q91 K109 A111 N113 G114
Binding residue
(residue number reindexed from 1)		H5 L6 T7 W18 Q59 K72 A74 N76 G77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7b5f, PDBe:7b5f, PDBj:7b5f
PDBsum7b5f
PubMed
UniProtP55899|FCGRN_HUMAN IgG receptor FcRn large subunit p51 (Gene Name=FCGRT)

[Back to BioLiP]