Structure of PDB 7apd Chain G Binding Site BS01

Receptor Information

>7apd Chain G (length=152) Species: 10571 (Bovine papillomavirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSRATVFKLGLFKSLFLCSFHDITRLFKNDKTTNQQWVLAVFGLAEVFFE
ASFELLKKQCSFLQMQKRSHEGGTCAVYLICFNTAKSRETVRNLMANMLN
VREECLMLQPPKIRGLSAALFWFKSSLSPATLKHGALPEWIRAQTTLNAA
AA

Ligand information

>7apd Chain T (length=36) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cccccccgtgcgcgctgaggtgcggtgtgaaataca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7apd Unwinding of a DNA replication fork by a hexameric viral helicase.
Resolution	3.9 Å
Binding residue (original residue number in PDB)	L181 F182 T187 N189
Binding residue (residue number reindexed from 1)	L26 F27 T32 N34

Enzymatic activity

Enzyme Commision number

3.6.4.12: DNA helicase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:7apd, PDBe:7apd, PDBj:7apd
PDBsum	7apd
PubMed	34545080
UniProt	P03116\|VE1_BPV1 Replication protein E1 (Gene Name=E1)

[Back to BioLiP]