Structure of PDB 7ad8 Chain G Binding Site BS01

Receptor Information
>7ad8 Chain G (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDC
DLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEA
KEVRQENREKMKQKKFDKKVKELRRAVRSSVWKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ad8 The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		L138 T140 T142 H171 M178
Binding residue
(residue number reindexed from 1)		L35 T37 T39 H68 M75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0005515 protein binding
GO:0019904 protein domain specific binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000715 nucleotide-excision repair, DNA damage recognition
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006289 nucleotide-excision repair
GO:0009650 UV protection
GO:0010996 response to auditory stimulus
GO:0034504 protein localization to nucleus
GO:0070914 UV-damage excision repair
GO:1901255 nucleotide-excision repair involved in interstrand cross-link repair
Cellular Component
GO:0000110 nucleotide-excision repair factor 1 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005662 DNA replication factor A complex
GO:0045171 intercellular bridge

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ad8, PDBe:7ad8, PDBj:7ad8
PDBsum7ad8
PubMed33166411
UniProtP23025|XPA_HUMAN DNA repair protein complementing XP-A cells (Gene Name=XPA)

[Back to BioLiP]