Structure of PDB 6z9r Chain G Binding Site BS01

Receptor Information
>6z9r Chain G (length=112) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGG
QRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISD
KEVDAIMNRLQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6z9r Steps toward translocation-independent RNA polymerase inactivation by terminator ATPase rho.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		F15 R57 K59
Binding residue
(residue number reindexed from 1)		F10 R52 K54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006354 DNA-templated transcription elongation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6z9r, PDBe:6z9r, PDBj:6z9r
PDBsum6z9r
PubMed33243850
UniProtP0AFG0|NUSG_ECOLI Transcription termination/antitermination protein NusG (Gene Name=nusG)

[Back to BioLiP]