Structure of PDB 6xn5 Chain G Binding Site BS01

Receptor Information
>6xn5 Chain G (length=214) Species: 1360 (Lactococcus lactis subsp. lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLVIEGTIVLKTGMHIGGSSDFSAIGAVASPVVRDTLTRLPLIPGSSLK
GKMRYLLAKELNNGILLNEPNNDQDEILRLFGSSEKDKIRRARLKFNDIK
LSNLAELETFNVSSTEVKFENTINRKTAVANPRQIERVIAGSKFDFEIFY
NLDDIKEVEKDFENIKQGFDLLEFDYLGGHGTRGSGRIAFENLSVITAVG
NFEKINTLNEILGA
Ligand information
>6xn5 Chain R (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgagaacauacguucuuugaaccaagcuuca
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xn5 Structural and biochemical characterization of in vivo assembled Lactococcus lactis CRISPR-Csm complex.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		G18 G19 S47 S48 K50 G51 K52 R54 G82 S84 F119 E120 N121 T122 I123 A130 P132 R133 Y176 G178 G179 T182 R183
Binding residue
(residue number reindexed from 1)		G18 G19 S47 S48 K50 G51 K52 R54 G82 S84 F119 E120 N121 T122 I123 A130 P132 R133 Y176 G178 G179 T182 R183
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6xn5, PDBe:6xn5, PDBj:6xn5
PDBsum6xn5
PubMed35351985
UniProtL0CEA3

[Back to BioLiP]