Structure of PDB 6xlk Chain G Binding Site BS01

Receptor Information

>6xlk Chain G (length=268) Species: 562 (Escherichia coli)

SQIGLFSKICRVTIKTLHYYNKIGLLVPAYINPDNGYRFYTSDQLMKFHQ
IASLRQLGFTITEIVTLTQDENSCHIIERRRLEIQKQIRDMADMLSRINH
YLQHKKKERIMLYQAALKEIPECIVYSKRFIVPDFSSYIKLIPPIGQEVM
KANPGLTLTTPAYCFTLYHDKEYKEKNMDVEFCEAVNDFGKNEGNIIFQV
IPAITAVTVIHKGPYDSLRNAYIYLMQWVEDNGYLLTNSPRESYIDGIWN
KQDSAEWMTEIQFPVEKV

Ligand information

>6xlk Chain N (length=23)

gaccctcccctaaggggagggtt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6xlk Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): T14 K16 T17 Y20 Y21 R56 T61 I62
• Binding residue (residue number reindexed from 1): T13 K15 T16 Y19 Y20 R55 T60 I61

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 19:07:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6xlk', asym_id = 'G', bs = 'BS01', title = 'Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6xlk', asym_id='G', bs='BS01', title='Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003677,0003700,0006355', uniprot = '', pdbid = '6xlk', asym_id = 'G'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003700,0006355', uniprot='', pdbid='6xlk', asym_id='G')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>