Structure of PDB 6xlj Chain G Binding Site BS01

Receptor Information
>6xlj Chain G (length=268) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQIGLFSKICRVTIKTLHYYNKIGLLVPAYINPDNGYRFYTSDQLMKFHQ
IASLRQLGFTITEIVTLTQDENSCHIIERRRLEIQKQIRDMADMLSRINH
YLQHKKKERIMLYQAALKEIPECIVYSKRFIVPDFSSYIKLIPPIGQEVM
KANPGLTLTTPAYCFTLYHDKEYKEKNMDVEFCEAVNDFGKNEGNIIFQV
IPAITAVTVIHKGPYDSLRNAYIYLMQWVEDNGYLLTNSPRESYIDGIWN
KQDSAEWMTEIQFPVEKV
Ligand information
>6xlj Chain N (length=54) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccttgaccctcccctaaggggagggtttagattgtgtgcagtctgacgc
ggcg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xlj Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T14 K16 T17 Y20 Y21 R56 T61 I62
Binding residue
(residue number reindexed from 1)		T13 K15 T16 Y19 Y20 R55 T60 I61
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 11:13:25 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6xlj', asym_id = 'G', bs = 'BS01', title = 'Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6xlj', asym_id='G', bs='BS01', title='Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003677,0003700,0006355', uniprot = '', pdbid = '6xlj', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003700,0006355', uniprot='', pdbid='6xlj', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>