Structure of PDB 6xh8 Chain G Binding Site BS01

Receptor Information
>6xh8 Chain G (length=130) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLL
RQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQS
MRDQLLALANACPGDDSADCPIIENLSGCC
Ligand information
>6xh8 Chain 1 (length=54) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccttgaccttccccttgctggaaggtttaacctgtgtgcagtctgacgc
ggcg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xh8 Structural basis of copper-efflux-regulator-dependent transcription activation.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		K15 F19 Y20 L60
Binding residue
(residue number reindexed from 1)		K15 F19 Y20 L60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005507 copper ion binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xh8, PDBe:6xh8, PDBj:6xh8
PDBsum6xh8
PubMed34113812
UniProtP0A9G4|CUER_ECOLI HTH-type transcriptional regulator CueR (Gene Name=cueR)

[Back to BioLiP]